Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC43 Peptide - N-terminal region

CCDC43 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31795

UniProt

Q96MW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC43 Rabbit Polyclonal Antibody (orb581488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653210

Preservative

Lyophilized powder

AA Sequence

APGEGDGGGGGFGSWLDGRLEALGVDRAVYGAYILGILQEEEEEEKLDAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Phenazinecarboxylic Acid
TRC-P295325-50MG 50 mg

1-Phenazinecarboxylic Acid

Sign In for Pricing
View Details
Human ProGRP Antibody Pair Set
E-KAB-0484 50 µL & 100 µg

Human ProGRP Antibody Pair Set

Sign In for Pricing
View Details
Recombinant Human Carbonic Anhydrase 3/CA3 Protein (His Tag)
PKSH031566-01 100 µg

Recombinant Human Carbonic Anhydrase 3/CA3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Carbonic Anhydrase 3/CA3 Protein (His Tag)
PKSH031566-02 1 mg

Recombinant Human Carbonic Anhydrase 3/CA3 Protein (His Tag)

Sign In for Pricing
View Details
Allyl Ether
TRC-A552625-50ML 50 mL

Allyl Ether

Sign In for Pricing
View Details
Fos (Ab-362) Antibody
8B0429-AAT 50 µg

Fos (Ab-362) Antibody

Sign In for Pricing
View Details