Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC43 Peptide - N-terminal region

CCDC43 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31795

UniProt

Q96MW1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC43 Rabbit Polyclonal Antibody (orb581488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653210

Preservative

Lyophilized powder

AA Sequence

APGEGDGGGGGFGSWLDGRLEALGVDRAVYGAYILGILQEEEEEEKLDAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epstein-Barr Virus (LMP-1) (CS2), 1mg/mL
BNUM1742-50 1x 50 µL

Epstein-Barr Virus (LMP-1) (CS2), 1mg/mL

Sign In for Pricing
View Details
AG490
SIH-428-25MG 25 mg

AG490

Sign In for Pricing
View Details
Tal1 (TAL1/3146), CF640R conjugate, 0.1mg/mL
BNC403146-100 1x 100 µL

Tal1 (TAL1/3146), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CD150/SLAMF1 Protein (His Tag)
PKSH031402 100 µg

Recombinant Human CD150/SLAMF1 Protein (His Tag)

Sign In for Pricing
View Details
DNMT3A Polyclonal Antibody
E-AB-14623-01 20 µL

DNMT3A Polyclonal Antibody

Sign In for Pricing
View Details
DNMT3A Polyclonal Antibody
E-AB-14623-02 60 µL

DNMT3A Polyclonal Antibody

Sign In for Pricing
View Details