Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grap Peptide - middle region

Grap Peptide - middle region

Product Specifications

Product Name Alternative

MGC112733

UniProt

Q4KM68

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Grap Rabbit Polyclonal Antibody (orb330671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020920

Preservative

Lyophilized powder

AA Sequence

GDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYRTTTIAKRRQIFLCDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fra10ac1 shRNA (UAS) - Lentiviral mouse Fra10ac1 shRNA (UAS) (100)
GTR15212058 1 Vial

Lentiviral mouse Fra10ac1 shRNA (UAS) - Lentiviral mouse Fra10ac1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Lentiviral mouse Sp3 shRNA (UAS) - Lentiviral mouse Sp3 shRNA (UAS) (100)
GTR15195174 1 Vial

Lentiviral mouse Sp3 shRNA (UAS) - Lentiviral mouse Sp3 shRNA (UAS) (100)

Sign In for Pricing
View Details
IFNG (Interferon gamma, IFN-gamma, Immune interferon) (FITC) discontinued
138036-FITC 100 µL

IFNG (Interferon gamma, IFN-gamma, Immune interferon) (FITC) discontinued

Sign In for Pricing
View Details
Rat Fasn Pre-designed siRNA Set B
SI204884B 1 Each

Rat Fasn Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cyclic AMP (cAMP) Activity Fluorometric Assay Kit
TBS2081-100 100 Tests

Cyclic AMP (cAMP) Activity Fluorometric Assay Kit

Sign In for Pricing
View Details
Lurasidone-d8 Hydrochloride
015722 1 mg

Lurasidone-d8 Hydrochloride

Sign In for Pricing
View Details