Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crygs Peptide - C-terminal region

Crygs Peptide - C-terminal region

Product Specifications

UniProt

P0C5E9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Crygs Rabbit Polyclonal Antibody (orb581685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001103023

Preservative

Lyophilized powder

AA Sequence

RFHLREIHSCKVLEGTWIFYELPSYHGRQYLLDKKEYRKPVDWGAASPAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXQ1 Mouse Monoclonal Antibody [Clone ID: OTI4D9]
CF808148 100 µg

FOXQ1 Mouse Monoclonal Antibody [Clone ID: OTI4D9]

Sign In for Pricing
View Details
Human C10orf78 (SFR1) activation kit by CRISPRa
GA114686 1 Kit

Human C10orf78 (SFR1) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human NEDD8 Protein (His Tag, SUMO Tag)
PKSH032791-01 10 µg

Recombinant Human NEDD8 Protein (His Tag, SUMO Tag)

Sign In for Pricing
View Details
Recombinant Human NEDD8 Protein (His Tag, SUMO Tag)
PKSH032791-02 50 µg

Recombinant Human NEDD8 Protein (His Tag, SUMO Tag)

Sign In for Pricing
View Details
ELMO1 Rabbit Polyclonal Antibody
TA369103 100 µL

ELMO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MSK1 (Ab-360) Antibody
8B0685-AAT 50 µg

MSK1 (Ab-360) Antibody

Sign In for Pricing
View Details