Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crygs Peptide - C-terminal region

Crygs Peptide - C-terminal region

Product Specifications

UniProt

P0C5E9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Crygs Rabbit Polyclonal Antibody (orb581685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001103023

Preservative

Lyophilized powder

AA Sequence

RFHLREIHSCKVLEGTWIFYELPSYHGRQYLLDKKEYRKPVDWGAASPAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Ethyl N1,N3-Bis(descyclohexyl) N1,N3-Bis(trans-Cyclohexyl) Daprodustat 4-Dibenzoate
TRC-E193375-10MG 10 mg

2-Ethyl N1,N3-Bis(descyclohexyl) N1,N3-Bis(trans-Cyclohexyl) Daprodustat 4-Dibenzoate

Sign In for Pricing
View Details
EIF4E pSer209 Rabbit Polyclonal Antibody
AP20885PU-N 100 µg

EIF4E pSer209 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GAPDHS Rabbit Polyclonal Antibody
TA366938 100 µL

GAPDHS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPT / TAU Rabbit Polyclonal Antibody
AP02627PU-S 50 µL

MAPT / TAU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pentanoic-5,5,5-d3 Acid
TRC-P274360-50MG 50 mg

Pentanoic-5,5,5-d3 Acid

Sign In for Pricing
View Details
5-Fluoroindazole-3-carboxylic Acid Sodium Salt
TRC-F591940-1G 1 g

5-Fluoroindazole-3-carboxylic Acid Sodium Salt

Sign In for Pricing
View Details