Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

St6galnac2 Peptide - middle region

St6galnac2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC124782, Siat7b

UniProt

Q6ZYN8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with St6galnac2 Rabbit Polyclonal Antibody (orb582170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001026822

Preservative

Lyophilized powder

AA Sequence

SAILGVPVPEGPDKGDRPHIYFGPETSASKFKLLHPDFIGYLTERFLKSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC10A Rabbit Polyclonal Antibody
TA368783 100 µL

CLEC10A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561080 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
ZNF8 Mouse Monoclonal Antibody [Clone ID: OTI5G1]
CF811989 100 µg

ZNF8 Mouse Monoclonal Antibody [Clone ID: OTI5G1]

Sign In for Pricing
View Details
HOXA10 Goat Polyclonal Antibody
AP32972PU-N 100 µg

HOXA10 Goat Polyclonal Antibody

Sign In for Pricing
View Details
2-(2-(Benzylamino)-2-oxoethyl)-5-(4-(2-morpholinoethoxy)phenyl)pyridine 1-oxide
TRC-B889520-50MG 50 mg

2-(2-(Benzylamino)-2-oxoethyl)-5-(4-(2-morpholinoethoxy)phenyl)pyridine 1-oxide

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS633211 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details