Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

St6galnac2 Peptide - middle region

St6galnac2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC124782, Siat7b

UniProt

Q6ZYN8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with St6galnac2 Rabbit Polyclonal Antibody (orb582170) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001026822

Preservative

Lyophilized powder

AA Sequence

SAILGVPVPEGPDKGDRPHIYFGPETSASKFKLLHPDFIGYLTERFLKSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Cecum
CS630795 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105T-01 50 Tests

Elab Fluor® Violet 610 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105T-02 100 Tests

Elab Fluor® Violet 610 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105T-03 2x 100 Tests

Elab Fluor® Violet 610 Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
Myoglobin (Muscle Cell Marker) (rMB/2105), CF568 conjugate, 0.1mg/mL
BNC683800-500 1x 500 µL

Myoglobin (Muscle Cell Marker) (rMB/2105), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Biphenylyl Sulfate Potassium Salt
TRC-B397895-500MG 500 mg

2-Biphenylyl Sulfate Potassium Salt

Sign In for Pricing
View Details