Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB12 Peptide - N-terminal region

SERPINB12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC119247, MGC119248, YUKOPIN

UniProt

Q96P63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB12 Rabbit Polyclonal Antibody (orb584243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_536722

Preservative

Lyophilized powder

AA Sequence

LGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSNKQKAGSLNNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf15 Protein Vector (Human) (pPB-C-His)
PV006529 500 ng

C5orf15 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Canine Mannosidase Alpha Class 1A Member 1 ELISA Kit
MBS062438-01 48 Well

Canine Mannosidase Alpha Class 1A Member 1 ELISA Kit

Sign In for Pricing
View Details
Canine Mannosidase Alpha Class 1A Member 1 ELISA Kit
MBS062438-02 96 Well

Canine Mannosidase Alpha Class 1A Member 1 ELISA Kit

Sign In for Pricing
View Details
Canine Mannosidase Alpha Class 1A Member 1 ELISA Kit
MBS062438-03 5x 96 Well

Canine Mannosidase Alpha Class 1A Member 1 ELISA Kit

Sign In for Pricing
View Details
Canine Mannosidase Alpha Class 1A Member 1 ELISA Kit
MBS062438-04 10x 96 Well

Canine Mannosidase Alpha Class 1A Member 1 ELISA Kit

Sign In for Pricing
View Details
CDH12 Protein Lysate
OCOA13294-20UG 20 µg

CDH12 Protein Lysate

Sign In for Pricing
View Details