Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB12 Peptide - N-terminal region

SERPINB12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC119247, MGC119248, YUKOPIN

UniProt

Q96P63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB12 Rabbit Polyclonal Antibody (orb584243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_536722

Preservative

Lyophilized powder

AA Sequence

LGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSNKQKAGSLNNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7K1P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV738478 1.0 µg DNA

OR7K1P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
NEU1 Rabbit pAb
E2506299 100 µL

NEU1 Rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12/DH10B) YNFA Polyclonal Antibody
MBS7184839 Inquire

Rabbit anti-Escherichia coli (strain K12/DH10B) YNFA Polyclonal Antibody

Sign In for Pricing
View Details
Trhde (NM_001108991) Rat Tagged ORF Clone
RR211716 10 µg

Trhde (NM_001108991) Rat Tagged ORF Clone

Sign In for Pricing
View Details
2-methyl-1- (2H-1,2,3,4-tetrazol-5-yl) propan-1-amine
sc-342972 250 mg

2-methyl-1- (2H-1,2,3,4-tetrazol-5-yl) propan-1-amine

Sign In for Pricing
View Details
Cystatin SN (CST1) Human shRNA Plasmid Kit (Locus ID 1469)
TL319832 1 Kit

Cystatin SN (CST1) Human shRNA Plasmid Kit (Locus ID 1469)

Sign In for Pricing
View Details