Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Utp15 Peptide - middle region

Utp15 Peptide - middle region

Product Specifications

Product Name Alternative

AW544865

UniProt

Q8C7V3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Utp15 Rabbit Polyclonal Antibody (orb584709) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849249

Preservative

Lyophilized powder

AA Sequence

DETIVVGMTNGILSVKHRKSEAKKTSLPRRRRPAYRTFIKGKNYLKQRDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3β Mouse Monoclonal Antibody (4D2)
E12-603 100 µg -100 µL

GSK3β Mouse Monoclonal Antibody (4D2)

Sign In for Pricing
View Details
Sox8 (NM_011447) Mouse Tagged ORF Clone Lentiviral Particle
MR207417L3V 200 µL

Sox8 (NM_011447) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Nogo 66 Receptor (Nogo Receptor, NgR, NOGOR, Reticulon-4 Receptor, RTN4R, UNQ330/PRO526)
N2116-95K 50 µg

Nogo 66 Receptor (Nogo Receptor, NgR, NOGOR, Reticulon-4 Receptor, RTN4R, UNQ330/PRO526)

Sign In for Pricing
View Details
DHX34 Peptide - middle region
MBS3228101-01 0.1 mg

DHX34 Peptide - middle region

Sign In for Pricing
View Details
DHX34 Peptide - middle region
MBS3228101-02 5x 0.1 mg

DHX34 Peptide - middle region

Sign In for Pricing
View Details
Nmd3 ORF Vector (Rat) (pORF)
31938016 1.0 µg DNA

Nmd3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details