Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL36 Peptide - N-terminal region

RPL36 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp566B023, L36

UniProt

Q9Y3U8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL36 Rabbit Polyclonal Antibody (orb586125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056229

Preservative

Lyophilized powder

AA Sequence

KGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F-Box Protein 5 (FBXO5) Antibody
abx233047 100 µg

F-Box Protein 5 (FBXO5) Antibody

Sign In for Pricing
View Details
Horse IL1RA (Interleukin 1 Receptor Antagonist) ELISA Kit
ELK5900-01 48 Tests

Horse IL1RA (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
Horse IL1RA (Interleukin 1 Receptor Antagonist) ELISA Kit
ELK5900-02 96 Tests

Horse IL1RA (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
Horse IL1RA (Interleukin 1 Receptor Antagonist) ELISA Kit
ELK5900-03 5x 96 Tests

Horse IL1RA (Interleukin 1 Receptor Antagonist) ELISA Kit

Sign In for Pricing
View Details
GRHPR Antibody - N-terminal region
MBS3221918-01 0.1 mL

GRHPR Antibody - N-terminal region

Sign In for Pricing
View Details
GRHPR Antibody - N-terminal region
MBS3221918-02 5x 0.1 mL

GRHPR Antibody - N-terminal region

Sign In for Pricing
View Details