Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPYSL4 Peptide - C-terminal region

DPYSL4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CRMP3, DRP-4, ULIP4

UniProt

O14531

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPYSL4 Rabbit Polyclonal Antibody (orb586214) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006417

Preservative

Lyophilized powder

AA Sequence

MVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIARRTAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNB4 (NM_001145798) Human Over-expression Lysate
LY429012 100 µg

CACNB4 (NM_001145798) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccdc112 Mouse Gene Knockout Kit (CRISPR)
KN502637 1 Kit

Ccdc112 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TGF alpha (TGFA) Human Gene Knockout Kit (CRISPR)
KN202741RB 1 Kit

TGF alpha (TGFA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GBA3 Antibody
8C15299-AAT 50 µg

GBA3 Antibody

Sign In for Pricing
View Details
Cathepsin S Antibody
KC-14268-01 50 μL

Cathepsin S Antibody

Sign In for Pricing
View Details
Cathepsin S Antibody
KC-14268-02 100 µL

Cathepsin S Antibody

Sign In for Pricing
View Details