Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3J Peptide - C-terminal region

EIF3J Peptide - C-terminal region

Product Specifications

Product Name Alternative

EIF3S1, eIF3-alpha, eIF3-p35

UniProt

O75822

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF3J Rabbit Polyclonal Antibody (orb586216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003749

Preservative

Lyophilized powder

AA Sequence

VLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDY

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Nesprin 2 (Nesp2) ELISA Kit
EK15692 48 Tests

Human Nesprin 2 (Nesp2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-PCTAIRE2 antibody
SL11574R-01 50 µL

Rabbit Anti-PCTAIRE2 antibody

Sign In for Pricing
View Details
Rabbit Anti-PCTAIRE2 antibody
SL11574R-02 100 µL

Rabbit Anti-PCTAIRE2 antibody

Sign In for Pricing
View Details
UIA Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61888R-BF350-01 20 µL

UIA Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
UIA Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61888R-BF350-02 100 µL

UIA Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Lycoramine (hydrobromide)
HY-N6619 1 Each

Lycoramine (hydrobromide)

Sign In for Pricing
View Details