Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3J Peptide - C-terminal region

EIF3J Peptide - C-terminal region

Product Specifications

Product Name Alternative

EIF3S1, eIF3-alpha, eIF3-p35

UniProt

O75822

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF3J Rabbit Polyclonal Antibody (orb586216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003749

Preservative

Lyophilized powder

AA Sequence

VLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDY

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK38L Polyclonal Antibody
A61190-100 100 µL

STK38L Polyclonal Antibody

Sign In for Pricing
View Details
DEFB124 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-14252R-APC-Cy5.5 100 µL

DEFB124 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Hsa-miR-6074 miRNA Mimic
orb1876805-01 5 nmol

Hsa-miR-6074 miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-6074 miRNA Mimic
orb1876805-02 10 nmol

Hsa-miR-6074 miRNA Mimic

Sign In for Pricing
View Details
OR6B1 Human shRNA Plasmid Kit (Locus ID 135946)
TL310733 1 Kit

OR6B1 Human shRNA Plasmid Kit (Locus ID 135946)

Sign In for Pricing
View Details
DNM1 ELISA Kit (Human) (OKEH01396)
OKEH01396 96 Well

DNM1 ELISA Kit (Human) (OKEH01396)

Sign In for Pricing
View Details