Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABRAXAS1 Peptide - C-terminal region

ABRAXAS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABRA1, CCDC98, FAM175A

UniProt

Q6UWZ7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABRAXAS1 Rabbit Polyclonal Antibody (orb586218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620775

Preservative

Lyophilized powder

AA Sequence

DDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS13B Mouse Monoclonal Antibody [Clone ID: OTI6F6]
CF807801 100 µg

VPS13B Mouse Monoclonal Antibody [Clone ID: OTI6F6]

Sign In for Pricing
View Details
WNT7A antibody
FNab09522 100 µg

WNT7A antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS622025 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
TORC1 (CRTC1) (NM_001098482) Human Recombinant Protein
TP324693L 1 mg

TORC1 (CRTC1) (NM_001098482) Human Recombinant Protein

Sign In for Pricing
View Details
Human SCmL4 activation kit by CRISPRa
GA116861 1 Kit

Human SCmL4 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse MMP12/MMP-12/HME Protein (His Tag)
PKSM041106-01 10 µg

Recombinant Mouse MMP12/MMP-12/HME Protein (His Tag)

Sign In for Pricing
View Details