Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABRAXAS1 Peptide - C-terminal region

ABRAXAS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ABRA1, CCDC98, FAM175A

UniProt

Q6UWZ7

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ABRAXAS1 Rabbit Polyclonal Antibody (orb586218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620775

Preservative

Lyophilized powder

AA Sequence

DDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN2A Antibody
KC-167-01 50 μL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
KC-167-02 100 µL

CDKN2A Antibody

Sign In for Pricing
View Details
CDKN2A Antibody
KC-167-03 1 mL

CDKN2A Antibody

Sign In for Pricing
View Details
POGLUT3 Mouse Monoclonal Antibody [Clone ID: OTI5G2]
CF809568 100 µg

POGLUT3 Mouse Monoclonal Antibody [Clone ID: OTI5G2]

Sign In for Pricing
View Details
C9orf23 (RPP25L) (NM_148178) Human Recombinant Protein
TP305700M 100 µg

C9orf23 (RPP25L) (NM_148178) Human Recombinant Protein

Sign In for Pricing
View Details
Water Chiller BCHI-311
BCHI-311 Each

Water Chiller BCHI-311

Sign In for Pricing
View Details