GNA14 Peptide - N-terminal region
GNA14 Peptide - N-terminal region
Product Specifications
UniProt
O95837
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GNA14 Rabbit Polyclonal Antibody (orb586220) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004288
Preservative
Lyophilized powder
AA Sequence
QLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400031-500 1x 500 µL
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
