Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA3 Peptide - C-terminal region

LILRA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD85E, HM31, HM43, ILT6, LIR-4, LIR4, e3

UniProt

Q8N6C8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRA3 Rabbit Polyclonal Antibody (orb586226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006856

Preservative

Lyophilized powder

AA Sequence

AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FastScan™ Total Rb ELISA Kit
CST 23595V2 10 Kits

FastScan™ Total Rb ELISA Kit

Sign In for Pricing
View Details
Hnrnpm sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6980006 1.0 µg DNA

Hnrnpm sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
2- (2-Acetylphenyl) sulfanylbenzoic acid
BUP23243-01 2 mg

2- (2-Acetylphenyl) sulfanylbenzoic acid

Sign In for Pricing
View Details
2- (2-Acetylphenyl) sulfanylbenzoic acid
BUP23243-02 10 mg

2- (2-Acetylphenyl) sulfanylbenzoic acid

Sign In for Pricing
View Details
Olfr1362 shRNA (m) Lentiviral Particles
sc-150514-V 200 µL

Olfr1362 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
CD161 shRNA (h) Lentiviral Particles
sc-42935-V 200 µL

CD161 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details