Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRA3 Peptide - C-terminal region

LILRA3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD85E, HM31, HM43, ILT6, LIR-4, LIR4, e3

UniProt

Q8N6C8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRA3 Rabbit Polyclonal Antibody (orb586226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006856

Preservative

Lyophilized powder

AA Sequence

AADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (MaxLight 550)
MBS6385826-01 0.1 mL

MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (MaxLight 550)

Sign In for Pricing
View Details
MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (MaxLight 550)
MBS6385826-02 5x 0.1 mL

MPP5 (MAGUK p55 Subfamily Member 5, FLJ12615, PALS1) (MaxLight 550)

Sign In for Pricing
View Details
Hexdc siRNA Oligos set (Rat)
23223176 3x 5 nmol

Hexdc siRNA Oligos set (Rat)

Sign In for Pricing
View Details
ATOH7 (Atonal Homolog 7 (Drosophila), Math5, bHLHa13) (MaxLight 490)
MBS6205265-01 0.1 mL

ATOH7 (Atonal Homolog 7 (Drosophila), Math5, bHLHa13) (MaxLight 490)

Sign In for Pricing
View Details
ATOH7 (Atonal Homolog 7 (Drosophila), Math5, bHLHa13) (MaxLight 490)
MBS6205265-02 5x 0.1 mL

ATOH7 (Atonal Homolog 7 (Drosophila), Math5, bHLHa13) (MaxLight 490)

Sign In for Pricing
View Details
Angiotensin II Type 1 Receptor Recombinant Rabbit mAb
ARM2901-01 30 µL

Angiotensin II Type 1 Receptor Recombinant Rabbit mAb

Sign In for Pricing
View Details