MATN4 Peptide - N-terminal region
MATN4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ14417, HE6WCR54
UniProt
A6NNA4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MATN4 Rabbit Polyclonal Antibody (orb586227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_085095
Preservative
Lyophilized powder
AA Sequence
LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
DDA62126-01 50 mg
N-Methyl-N-N-propyl-2-aminotetraline hydrochloride
Sign In for Pricing
View Details DDA62126-02 100 mg
N-Methyl-N-N-propyl-2-aminotetraline hydrochloride
Sign In for Pricing
View Details 
orb988674 100 µL
Phospho-NDRG1 (Thr346) Rabbit Polyclonal Antibody (Cy3)
Sign In for Pricing
View Details MBS7224511-01 48 Well
Goat Chromodomain-helicase-DNA-binding protein 7 (CHD7) ELISA Kit
Sign In for Pricing
View Details