Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1B Peptide - C-terminal region

MOB1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

MATS2, MGC33910, MOB4A, Mob1B

UniProt

Q7L9L4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOB1B Rabbit Polyclonal Antibody (orb586230) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775739

Preservative

Lyophilized powder

AA Sequence

FDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-allyl-5- (2-piperidin-1-ylethyl) -4H-1,2,4-triazole-3-thiol
sc-349025A 1 g

4-allyl-5- (2-piperidin-1-ylethyl) -4H-1,2,4-triazole-3-thiol

Sign In for Pricing
View Details
Brexpiprazole Impurity 132
RM-R182532-01 10 mg

Brexpiprazole Impurity 132

Sign In for Pricing
View Details
Brexpiprazole Impurity 132
RM-R182532-02 25 mg

Brexpiprazole Impurity 132

Sign In for Pricing
View Details
Brexpiprazole Impurity 132
RM-R182532-03 50 mg

Brexpiprazole Impurity 132

Sign In for Pricing
View Details
Brexpiprazole Impurity 132
RM-R182532-04 100 mg

Brexpiprazole Impurity 132

Sign In for Pricing
View Details
Monkey KLK6 ELISA Kit
EMKK0080 96 Tests

Monkey KLK6 ELISA Kit

Sign In for Pricing
View Details