Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOB1B Peptide - C-terminal region

MOB1B Peptide - C-terminal region

Product Specifications

Product Name Alternative

MATS2, MGC33910, MOB4A, Mob1B

UniProt

Q7L9L4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MOB1B Rabbit Polyclonal Antibody (orb586230) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775739

Preservative

Lyophilized powder

AA Sequence

FDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHD1L Recombinant Antibody, Biotin Conjugated
bsm-61977R-Biotin-01 20 µL

CHD1L Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CHD1L Recombinant Antibody, Biotin Conjugated
bsm-61977R-Biotin-02 100 µL

CHD1L Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
MPST Recombinant Protein
OPCD05386-200UG 200 µg

MPST Recombinant Protein

Sign In for Pricing
View Details
Anti-ERCC1 Antibody Picoband® Fluoro647 Conjugated
A00388-2-Fluoro647 100 µg/Vial

Anti-ERCC1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Tmbim1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K5015902 1.0 µg DNA

Tmbim1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rpl18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
40920116 3x 1.0 µg

Rpl18 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details