Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRFAP1 Peptide - N-terminal region

MRFAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAM14, PGR1

UniProt

Q9Y605

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRFAP1 Rabbit Polyclonal Antibody (orb586233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150638

Preservative

Lyophilized powder

AA Sequence

PVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQVEASEESAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Afm Mouse Gene Knockout Kit (CRISPR)
KN500961 1 Kit

Afm Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Ep-CAM/CD326 Antibody Pair Set
E-KAB-0422 50 µL & 100 µg

Human Ep-CAM/CD326 Antibody Pair Set

Sign In for Pricing
View Details
Cibisatamab Biosimilar - Research Grade
ICH5041-1mg 1 mg

Cibisatamab Biosimilar - Research Grade

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-100 1x 100 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PGR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12D1]
TA802609AM 100 µL

Progesterone Receptor (PGR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12D1]

Sign In for Pricing
View Details
LAMP2 Human Knockdown Lysate
LY300363 100 µg

LAMP2 Human Knockdown Lysate

Sign In for Pricing
View Details