Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRFAP1 Peptide - N-terminal region

MRFAP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PAM14, PGR1

UniProt

Q9Y605

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRFAP1 Rabbit Polyclonal Antibody (orb586233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150638

Preservative

Lyophilized powder

AA Sequence

PVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQVEASEESAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD3-APC/CD4-FITC/CD8a-PE Cocktail
E-AB-FC0008-01 20 Tests

Anti-Human CD3-APC/CD4-FITC/CD8a-PE Cocktail

Sign In for Pricing
View Details
Anti-Human CD3-APC/CD4-FITC/CD8a-PE Cocktail
E-AB-FC0008-02 100 Tests

Anti-Human CD3-APC/CD4-FITC/CD8a-PE Cocktail

Sign In for Pricing
View Details
Anti-Human CD3-APC/CD4-FITC/CD8a-PE Cocktail
E-AB-FC0008-03 2x 100 Tests

Anti-Human CD3-APC/CD4-FITC/CD8a-PE Cocktail

Sign In for Pricing
View Details
HuC (ELAVL3) (NM_001420) Human Over-expression Lysate
LY419944 100 µg

HuC (ELAVL3) (NM_001420) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Nuclear Antigen (235-1), CF543 conjugate, 0.1mg/mL
BNC430099-500 1x 500 µL

Human Nuclear Antigen (235-1), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl Benzenesulfonate
TRC-E708000-50MG 50 mg

Ethyl Benzenesulfonate

Sign In for Pricing
View Details