Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANS Peptide - C-terminal region

NANS Peptide - C-terminal region

Product Specifications

Product Name Alternative

SAS

UniProt

Q9NR45

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NANS Rabbit Polyclonal Antibody (orb331311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061819

Preservative

Lyophilized powder

AA Sequence

DMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MYH7 Antibody (MYH7/9183) [Allophycocyanin]
NBP3-26974APC 0.1 mL

Mouse Monoclonal MYH7 Antibody (MYH7/9183) [Allophycocyanin]

Sign In for Pricing
View Details
CCNB1IP1 (E3 Ubiquitin-protein Ligase CCNB1IP1, Cyclin-B1-interacting Protein 1, Human Enhancer of Invasion 10, C14orf18, HEI10)
124474 50 µg

CCNB1IP1 (E3 Ubiquitin-protein Ligase CCNB1IP1, Cyclin-B1-interacting Protein 1, Human Enhancer of Invasion 10, C14orf18, HEI10)

Sign In for Pricing
View Details
HSV 1/2 IgG Rapid Test Cassette
ISG-402 40 Tests

HSV 1/2 IgG Rapid Test Cassette

Sign In for Pricing
View Details
Rat Anti-Mouse CD5/Ly-1-FITC
MBS673177-01 0.5 mg

Rat Anti-Mouse CD5/Ly-1-FITC

Sign In for Pricing
View Details
Rat Anti-Mouse CD5/Ly-1-FITC
MBS673177-02 5x 0.5 mg

Rat Anti-Mouse CD5/Ly-1-FITC

Sign In for Pricing
View Details
Human Salmonella antibody IgM (SA IgM) ELISA Kit
YP-W13638-01 48 Tests

Human Salmonella antibody IgM (SA IgM) ELISA Kit

Sign In for Pricing
View Details