Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANS Peptide - C-terminal region

NANS Peptide - C-terminal region

Product Specifications

Product Name Alternative

SAS

UniProt

Q9NR45

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NANS Rabbit Polyclonal Antibody (orb331311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061819

Preservative

Lyophilized powder

AA Sequence

DMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDKRB1 Polyclonal Antibody
MBS8572510-01 0.1 mL

BDKRB1 Polyclonal Antibody

Sign In for Pricing
View Details
BDKRB1 Polyclonal Antibody
MBS8572510-02 0.1 mL (AF405L)

BDKRB1 Polyclonal Antibody

Sign In for Pricing
View Details
BDKRB1 Polyclonal Antibody
MBS8572510-03 0.1 mL (AF405S)

BDKRB1 Polyclonal Antibody

Sign In for Pricing
View Details
BDKRB1 Polyclonal Antibody
MBS8572510-04 0.1 mL (AF610)

BDKRB1 Polyclonal Antibody

Sign In for Pricing
View Details
BDKRB1 Polyclonal Antibody
MBS8572510-05 0.1 mL (AF635)

BDKRB1 Polyclonal Antibody

Sign In for Pricing
View Details
BDKRB1 Polyclonal Antibody
MBS8572510-06 0.1 mL (APC)

BDKRB1 Polyclonal Antibody

Sign In for Pricing
View Details