Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHOSPHO1 Peptide - C-terminal region

PHOSPHO1 Peptide - C-terminal region

Product Specifications

UniProt

Q8TCT1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHOSPHO1 Rabbit Polyclonal Antibody (orb586239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001137276

Preservative

Lyophilized powder

AA Sequence

GLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human TMEM254 (Transmembrane protein 254) Full Length
MPC1675K Each

Magic™ Membrane Protein Human TMEM254 (Transmembrane protein 254) Full Length

Sign In for Pricing
View Details
Ncoa4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7497206 1.0 µg DNA

Ncoa4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recaticimab (Anti-PCSK9)
C00749-1mg*25 25x 1mg

Recaticimab (Anti-PCSK9)

Sign In for Pricing
View Details
Mouse Monoclonal Ephrin-A2 Antibody (OTI3E3) [mFluor Violet 500 SE]
NBP2-70622MFV500 0.1 mL

Mouse Monoclonal Ephrin-A2 Antibody (OTI3E3) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
N-Cbz-beta-alanine
OR350305-01 25 g

N-Cbz-beta-alanine

Sign In for Pricing
View Details
N-Cbz-beta-alanine
OR350305-02 2.5 Kg

N-Cbz-beta-alanine

Sign In for Pricing
View Details