Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHOSPHO1 Peptide - C-terminal region

PHOSPHO1 Peptide - C-terminal region

Product Specifications

UniProt

Q8TCT1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHOSPHO1 Rabbit Polyclonal Antibody (orb586239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001137276

Preservative

Lyophilized powder

AA Sequence

GLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST3GAL3 Polyclonal Antibody, FITC Conjugated
A54286-050 50 µL

ST3GAL3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Rabbit Anti-Human ALCAM pAb
PA12872-01 50 μL

Rabbit Anti-Human ALCAM pAb

Sign In for Pricing
View Details
Rabbit Anti-Human ALCAM pAb
PA12872-02 100 μL

Rabbit Anti-Human ALCAM pAb

Sign In for Pricing
View Details
Horse COMP (Cartilage Oligomeric Matrix Protein) ELISA Kit
MBS8807267-01 48 Strip Well

Horse COMP (Cartilage Oligomeric Matrix Protein) ELISA Kit

Sign In for Pricing
View Details
Horse COMP (Cartilage Oligomeric Matrix Protein) ELISA Kit
MBS8807267-02 96 Strip Well

Horse COMP (Cartilage Oligomeric Matrix Protein) ELISA Kit

Sign In for Pricing
View Details
Horse COMP (Cartilage Oligomeric Matrix Protein) ELISA Kit
MBS8807267-03 5x 96 Strip Well

Horse COMP (Cartilage Oligomeric Matrix Protein) ELISA Kit

Sign In for Pricing
View Details