Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHOC2 Peptide - N-terminal region

SHOC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ60412, KIAA0862, SIAA0862, SOC-2, SOC2, SUR-8, SUR8

UniProt

Q9UQ13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHOC2 Rabbit Polyclonal Antibody (orb586241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031399

Preservative

Lyophilized powder

AA Sequence

EKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAAQPGVAFSVDNTIKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parn 3'UTR Lenti-reporter-Luc Vector
36021084 1.0 µg

Parn 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
BMI1 Antibody
MBS9435337-01 0.05 mL

BMI1 Antibody

Sign In for Pricing
View Details
BMI1 Antibody
MBS9435337-02 0.1 mL

BMI1 Antibody

Sign In for Pricing
View Details
BMI1 Antibody
MBS9435337-03 5x 0.1 mL

BMI1 Antibody

Sign In for Pricing
View Details
MTND4P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV735085 1.0 µg DNA

MTND4P5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
TFEB Peptide
orb1232241 0.05 mg

TFEB Peptide

Sign In for Pricing
View Details