Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHOC2 Peptide - N-terminal region

SHOC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ60412, KIAA0862, SIAA0862, SOC-2, SOC2, SUR-8, SUR8

UniProt

Q9UQ13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHOC2 Rabbit Polyclonal Antibody (orb586241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031399

Preservative

Lyophilized powder

AA Sequence

EKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAAQPGVAFSVDNTIKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-1 p20 (D-4) Alexa Fluor® 680
sc-398715 AF680 200 µg/mL

Caspase-1 p20 (D-4) Alexa Fluor® 680

Sign In for Pricing
View Details
ALDH1B1 Antibody
E51A00042 100 µL

ALDH1B1 Antibody

Sign In for Pricing
View Details
Genome polyprotein Antibody (HRP)
orb351714-01 50 µg

Genome polyprotein Antibody (HRP)

Sign In for Pricing
View Details
Genome polyprotein Antibody (HRP)
orb351714-02 100 µg

Genome polyprotein Antibody (HRP)

Sign In for Pricing
View Details
Thymosin beta 10 (TMSB10) (NM_021103) Human Tagged ORF Clone Lentiviral Particle
RC205097L3V 200 µL

Thymosin beta 10 (TMSB10) (NM_021103) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Z-Ala-Ala-OH
5-07100 100 g

Z-Ala-Ala-OH

Sign In for Pricing
View Details