Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Senp6 Peptide - C-terminal region

Senp6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810017C20Rik, E130319N12Rik, MGC38009, Susp1, mKIAA0797

UniProt

Q6P7W0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Senp6 Rabbit Polyclonal Antibody (orb581135) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_666115

Preservative

Lyophilized powder

AA Sequence

LAVVCFPGLEKPKYEPNPHYHENAVMQKTPSAEDSCVSSASEMGACSQNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC2P5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV742659 1.0 µg DNA

RCC2P5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
CDKN2AIP Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-4267R-BF750 100 µL

CDKN2AIP Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
E230016K23Rik Mouse shRNA Plasmid (Locus ID 414102)
TR508775 1 Kit

E230016K23Rik Mouse shRNA Plasmid (Locus ID 414102)

Sign In for Pricing
View Details
OTOR Antibody
orb524656-01 50 μL

OTOR Antibody

Sign In for Pricing
View Details
OTOR Antibody
orb524656-02 100 µL

OTOR Antibody

Sign In for Pricing
View Details
Recombinant Mouse SERPINA9 Protein, His (Fc)-Avi-tagged
SERPINA9-8048M 50 µg

Recombinant Mouse SERPINA9 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details