Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Senp6 Peptide - C-terminal region

Senp6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810017C20Rik, E130319N12Rik, MGC38009, Susp1, mKIAA0797

UniProt

Q6P7W0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Senp6 Rabbit Polyclonal Antibody (orb581135) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_666115

Preservative

Lyophilized powder

AA Sequence

LAVVCFPGLEKPKYEPNPHYHENAVMQKTPSAEDSCVSSASEMGACSQNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DNA Repair Protein RAD50 (RAD50)
RPU41220-01 50 µg

Recombinant Human DNA Repair Protein RAD50 (RAD50)

Sign In for Pricing
View Details
Recombinant Human DNA Repair Protein RAD50 (RAD50)
RPU41220-02 100 µg

Recombinant Human DNA Repair Protein RAD50 (RAD50)

Sign In for Pricing
View Details
Recombinant Human DNA Repair Protein RAD50 (RAD50)
RPU41220-03 1 mg

Recombinant Human DNA Repair Protein RAD50 (RAD50)

Sign In for Pricing
View Details
Formyl-Histone H2B type 2E (Lys117) Recombinant Antibody, Cy5.5 Conjugated
bsm-62408R-Cy5.5 100 µL

Formyl-Histone H2B type 2E (Lys117) Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
TRAP100 CRISPR Activation Plasmid (h)
sc-417318-ACT 20 µg

TRAP100 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
TEAD3-set siRNA/shRNA/RNAi Lentivector (Human)
46467091 4x 500 ng

TEAD3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details