Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TWF2 Peptide - N-terminal region

TWF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A6RP, A6r, MSTP011, PTK9L

UniProt

Q6IBS0

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TWF2 Rabbit Polyclonal Antibody (orb581666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009215

Preservative

Lyophilized powder

AA Sequence

MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1700026L06Rik (BC055108) Mouse Tagged ORF Clone
MG201385 10 µg

1700026L06Rik (BC055108) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tal1 (TAL1/2707), CF640R conjugate, 0.1mg/mL
BNC402707-500 1x 500 µL

Tal1 (TAL1/2707), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (rTIMP2/2335), CF640R conjugate, 0.1mg/mL
BNC402335-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (rTIMP2/2335), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSBP1 (HMGN5) Human Gene Knockout Kit (CRISPR)
KN402766 1 Kit

NSBP1 (HMGN5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Stearoyl-sn-glycerol
TRC-S686565-250MG 250 mg

1-Stearoyl-sn-glycerol

Sign In for Pricing
View Details
FAM3D Antibody
KC-1648-01 50 μL

FAM3D Antibody

Sign In for Pricing
View Details