Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTERF4 Peptide - C-terminal region

MTERF4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mterfd2, 1810059A23Rik, 4933412H03Rik

UniProt

Q8BVN4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTERF4 Rabbit Polyclonal Antibody (orb582069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835152

Preservative

Lyophilized powder

AA Sequence

LERLGRYQTPDKKGQTQIPNPSLRNILRVSEAEFLARTACSSVEEFQVFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UTP23 activation kit by CRISPRa
GA113490 1 Kit

Human UTP23 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS712887 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Human SGIP1 activation kit by CRISPRa
GA113450 1 Kit

Human SGIP1 activation kit by CRISPRa

Sign In for Pricing
View Details
KHDRBS2 Rabbit Polyclonal Antibody
TA362234 100 µL

KHDRBS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hmga1 (NM_001039356) Mouse Tagged ORF Clone
MG200385 10 µg

Hmga1 (NM_001039356) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IL12B Rabbit Polyclonal Antibody
AP20604PU-N 100 µg

IL12B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details