MTERF4 Peptide - C-terminal region
MTERF4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Mterfd2, 1810059A23Rik, 4933412H03Rik
UniProt
Q8BVN4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MTERF4 Rabbit Polyclonal Antibody (orb582069) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_835152
Preservative
Lyophilized powder
AA Sequence
LERLGRYQTPDKKGQTQIPNPSLRNILRVSEAEFLARTACSSVEEFQVFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY403116 100 µg
MS4A8B (MS4A8) (NM_031457) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC741198-500 1x 500 µL
Cytokeratin 7 (KRT7/1198), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941815-500 1x 500 µL
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 