REX2 Peptide - C-terminal region
REX2 Peptide - C-terminal region
Product Specifications
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
XP_002729616
Preservative
Lyophilized powder
AA Sequence
HSGEKPYKCSECDKYFSQQSNLSIHRRIHTGEKPYKCSECDKCFGYKGSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1880353-01 0.01 mg
Anti-CXCL1 antibody (DMC499); IgG1 Chimeric mAb
Sign In for Pricing
View Details MBS1880353-02 0.1 mg
Anti-CXCL1 antibody (DMC499); IgG1 Chimeric mAb
Sign In for Pricing
View Details MBS1880353-03 0.5 mg
Anti-CXCL1 antibody (DMC499); IgG1 Chimeric mAb
Sign In for Pricing
View Details MBS1880353-04 5x 0.5 mg
Anti-CXCL1 antibody (DMC499); IgG1 Chimeric mAb
Sign In for Pricing
View Details K2439902 1.0 µg DNA
TRAK1 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details