Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMELY Peptide - C-terminal region

AMELY Peptide - C-terminal region

Product Specifications

Product Name Alternative

AMGL, AMGY

UniProt

Q99218

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMELY Rabbit Polyclonal Antibody (orb325928) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001134

Preservative

Lyophilized powder

AA Sequence

QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr581 sgRNA CRISPR Lentivector set (Rat)
K7401601 3x 1.0 µg

Olr581 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
HYKK Human Over-expression Lysate
orb1342742 100 µg

HYKK Human Over-expression Lysate

Sign In for Pricing
View Details
4',5-Di-O-acetyl genistein
272776-01 2 mg

4',5-Di-O-acetyl genistein

Sign In for Pricing
View Details
4',5-Di-O-acetyl genistein
272776-02 5 mg

4',5-Di-O-acetyl genistein

Sign In for Pricing
View Details
4',5-Di-O-acetyl genistein
272776-03 10 mg

4',5-Di-O-acetyl genistein

Sign In for Pricing
View Details
4',5-Di-O-acetyl genistein
272776-04 25 mg

4',5-Di-O-acetyl genistein

Sign In for Pricing
View Details