Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMELY Peptide - C-terminal region

AMELY Peptide - C-terminal region

Product Specifications

Product Name Alternative

AMGL, AMGY

UniProt

Q99218

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AMELY Rabbit Polyclonal Antibody (orb325928) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001134

Preservative

Lyophilized powder

AA Sequence

QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Escherichia coli, Enterotoxin B discontinued
E3500-44B 1 mg

Escherichia coli, Enterotoxin B discontinued

Sign In for Pricing
View Details
Rat PVRIG Protein, His Tag (MALS verified)
PVG-R52H8-1mg 1 mg

Rat PVRIG Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
Mouse Monoclonal GFAP Antibody (5C10) [Alexa Fluor 350]
NBP1-05197AF350 0.1 mL

Mouse Monoclonal GFAP Antibody (5C10) [Alexa Fluor 350]

Sign In for Pricing
View Details
FAM90A8 shRNA (h) Lentiviral Particles
sc-77545-V 200 µL

FAM90A8 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
CENPH (Centromere Protein H)
477785 100 µL

CENPH (Centromere Protein H)

Sign In for Pricing
View Details
PTGER2 discontinued
393472 200 µL

PTGER2 discontinued

Sign In for Pricing
View Details