Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tdrd7 Peptide - C-terminal region

Tdrd7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC93175, Pctaire2bp

UniProt

Q9R1R4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tdrd7 Rabbit Polyclonal Antibody (orb582584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620226

Preservative

Lyophilized powder

AA Sequence

CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERBB1 Antibody
orb379726 100 µg

ERBB1 Antibody

Sign In for Pricing
View Details
Lentiviral human ITGB1 shRNA (UAS) - Lentiviral human ITGB1 shRNA (UAS, RFP) plasmid
GTR15283141 1 Vial

Lentiviral human ITGB1 shRNA (UAS) - Lentiviral human ITGB1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Recombinant Sodalis glossinidius UPF0756 membrane protein SG1722 (SG1722), partial
MBS7076838 Inquire

Recombinant Sodalis glossinidius UPF0756 membrane protein SG1722 (SG1722), partial

Sign In for Pricing
View Details
Mouse Monoclonal GIPR Antibody (591853) [Janelia Fluor 646]
FAB8210J 0.1 mL

Mouse Monoclonal GIPR Antibody (591853) [Janelia Fluor 646]

Sign In for Pricing
View Details
PTX4 Protein Vector (Human) (pPM-C-HA)
PV114348 500 ng

PTX4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TCF3 Antibody
CSB-PA023301HA01HU-01 50 µg

TCF3 Antibody

Sign In for Pricing
View Details