Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tdrd7 Peptide - C-terminal region

Tdrd7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC93175, Pctaire2bp

UniProt

Q9R1R4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tdrd7 Rabbit Polyclonal Antibody (orb582584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620226

Preservative

Lyophilized powder

AA Sequence

CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lgmn (NM_011175) Mouse Recombinant Protein
PM43414M5 20 µg

Lgmn (NM_011175) Mouse Recombinant Protein

Sign In for Pricing
View Details
Canine Acid Phosphatase 5 TartRate Resistant ELISA Kit
MBS737070-01 48 Well

Canine Acid Phosphatase 5 TartRate Resistant ELISA Kit

Sign In for Pricing
View Details
Canine Acid Phosphatase 5 TartRate Resistant ELISA Kit
MBS737070-02 96 Well

Canine Acid Phosphatase 5 TartRate Resistant ELISA Kit

Sign In for Pricing
View Details
Canine Acid Phosphatase 5 TartRate Resistant ELISA Kit
MBS737070-03 5x 96 Well

Canine Acid Phosphatase 5 TartRate Resistant ELISA Kit

Sign In for Pricing
View Details
Canine Acid Phosphatase 5 TartRate Resistant ELISA Kit
MBS737070-04 10x 96 Well

Canine Acid Phosphatase 5 TartRate Resistant ELISA Kit

Sign In for Pricing
View Details
SULT1A2, 1-295aa, Human, His tag, E.coli
E53A04088 50 µg

SULT1A2, 1-295aa, Human, His tag, E.coli

Sign In for Pricing
View Details