Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2M Peptide - N-terminal region

A2M Peptide - N-terminal region

Product Specifications

Product Name Alternative

CPAMD5, DKFZp779B086, FWP007, S863-7, A2MD

UniProt

P01023

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with A2M Rabbit Polyclonal Antibody (orb326285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000005

Preservative

Lyophilized powder

AA Sequence

PVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAS2L2 (C-term) Rabbit Polyclonal Antibody
AP51783PU-N 400 µL

GAS2L2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Human Gene Knockout Kit (CRISPR)
KN201075BN 1 Kit

STAT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TNR activation kit by CRISPRa
GA104935 1 Kit

Human TNR activation kit by CRISPRa

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF405S conjugate, 0.1mg/mL
BNC043006-100 1x 100 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XFD488 Phalloidin
23153-AAT 300 Tests

XFD488 Phalloidin

Sign In for Pricing
View Details
Tead2 Mouse Gene Knockout Kit (CRISPR)
KN517384 1 Kit

Tead2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details