Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A2M Peptide - N-terminal region

A2M Peptide - N-terminal region

Product Specifications

Product Name Alternative

CPAMD5, DKFZp779B086, FWP007, S863-7, A2MD

UniProt

P01023

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with A2M Rabbit Polyclonal Antibody (orb326285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000005

Preservative

Lyophilized powder

AA Sequence

PVPGHVTVSICRKYSDASDCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mixture of 3-hydroxybutyl acetate(major) and 1,3-Butanediyl diacetate (Minor) (Technical Grade)
TRC-H473780-10G 10 g

Mixture of 3-hydroxybutyl acetate(major) and 1,3-Butanediyl diacetate (Minor) (Technical Grade)

Sign In for Pricing
View Details
L-(-)-threo-3-Hydroxyaspartic acid
TRC-H801828-2.5MG 2.5 mg

L-(-)-threo-3-Hydroxyaspartic acid

Sign In for Pricing
View Details
Tsfm Mouse Gene Knockout Kit (CRISPR)
KN518330 1 Kit

Tsfm Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Human CD268 Antibody[H353-6G10]
AN006550P-01 25 µg

Purified Anti-Human CD268 Antibody[H353-6G10]

Sign In for Pricing
View Details
Purified Anti-Human CD268 Antibody[H353-6G10]
AN006550P-02 100 µg

Purified Anti-Human CD268 Antibody[H353-6G10]

Sign In for Pricing
View Details
MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C1]
TA500672AM 100 µL

MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C1]

Sign In for Pricing
View Details