Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FDPS Peptide - C-terminal region

FDPS Peptide - C-terminal region

Product Specifications

Product Name Alternative

FPPS, FPS

UniProt

Q8WMY2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FDPS Rabbit Polyclonal Antibody (orb584797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129294

Preservative

Lyophilized powder

AA Sequence

VKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GHITM Antibody
CSB-PA104968-01 50 μL

GHITM Antibody

Sign In for Pricing
View Details
GHITM Antibody
CSB-PA104968-02 100 µL

GHITM Antibody

Sign In for Pricing
View Details
DMP1 ORF Vector (Human) (pORF)
ORF012851 1.0 µg DNA

DMP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-Human CRP Monoclonal Antibody (1A324)
MHB99901 100 μg

Anti-Human CRP Monoclonal Antibody (1A324)

Sign In for Pricing
View Details
Vom1r39 Protein Vector (Rat) (pPM-C-HA)
PV315416 500 ng

Vom1r39 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Canine IgG3, lambda Isotype Control Antibody (HyHEL-10)
FQJ93020 100 μg

Canine IgG3, lambda Isotype Control Antibody (HyHEL-10)

Sign In for Pricing
View Details