Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FDPS Peptide - C-terminal region

FDPS Peptide - C-terminal region

Product Specifications

Product Name Alternative

FPPS, FPS

UniProt

Q8WMY2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FDPS Rabbit Polyclonal Antibody (orb584797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129294

Preservative

Lyophilized powder

AA Sequence

VKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCGC607 100mg
A22126-100 100 mg

NCGC607 100mg

Sign In for Pricing
View Details
DIO2 Antibody, FITC conjugated
CSB-PA821705LC01HU-01 50 µg

DIO2 Antibody, FITC conjugated

Sign In for Pricing
View Details
DIO2 Antibody, FITC conjugated
CSB-PA821705LC01HU-02 100 µg

DIO2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Elagolix Impurity 63
RM-E120163-01 10 mg

Elagolix Impurity 63

Sign In for Pricing
View Details
Elagolix Impurity 63
RM-E120163-02 25 mg

Elagolix Impurity 63

Sign In for Pricing
View Details
Elagolix Impurity 63
RM-E120163-03 50 mg

Elagolix Impurity 63

Sign In for Pricing
View Details