Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R1 Peptide - middle region

PPP4R1 Peptide - middle region

Product Specifications

Product Name Alternative

PP4 (Rmeg), PP4R1

UniProt

Q8TF05

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP4R1 Rabbit Polyclonal Antibody (orb585381) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035847

Preservative

Lyophilized powder

AA Sequence

EDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyocyanin (Technical Grade)
TRC-P840368-1MG 1 mg

Pyocyanin (Technical Grade)

Sign In for Pricing
View Details
Atp6ap1 Mouse Gene Knockout Kit (CRISPR)
KN301804BN 1 Kit

Atp6ap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSMA7 Mouse Monoclonal Antibody [Clone ID: OTI5F6]
CF810347 100 µg

PSMA7 Mouse Monoclonal Antibody [Clone ID: OTI5F6]

Sign In for Pricing
View Details
PLXNB2 Polyclonal Antibody
E-AB-90059-01 60 µL

PLXNB2 Polyclonal Antibody

Sign In for Pricing
View Details
PLXNB2 Polyclonal Antibody
E-AB-90059-02 120 µL

PLXNB2 Polyclonal Antibody

Sign In for Pricing
View Details
PLXNB2 Polyclonal Antibody
E-AB-90059-03 200 µL

PLXNB2 Polyclonal Antibody

Sign In for Pricing
View Details