Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R1 Peptide - middle region

PPP4R1 Peptide - middle region

Product Specifications

Product Name Alternative

PP4 (Rmeg), PP4R1

UniProt

Q8TF05

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP4R1 Rabbit Polyclonal Antibody (orb585381) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035847

Preservative

Lyophilized powder

AA Sequence

EDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAASNENDKKPGNYKSM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SAPCD1 activation kit by CRISPRa
GA118318 1 Kit

Human SAPCD1 activation kit by CRISPRa

Sign In for Pricing
View Details
alpha 2b Adrenergic Receptor (ADRA2B) Rabbit Polyclonal Antibody
TA373322 100 µL

alpha 2b Adrenergic Receptor (ADRA2B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHLSN Antibody
KC-1453-01 50 μL

CHLSN Antibody

Sign In for Pricing
View Details
CHLSN Antibody
KC-1453-02 100 µL

CHLSN Antibody

Sign In for Pricing
View Details
CHLSN Antibody
KC-1453-03 1 mL

CHLSN Antibody

Sign In for Pricing
View Details
RBMY1B (NM_001006121) Human Over-expression Lysate
LY423682 100 µg

RBMY1B (NM_001006121) Human Over-expression Lysate

Sign In for Pricing
View Details