Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMCH1 Peptide - C-terminal region

LIMCH1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434I0312, DKFZp686A01247, DKFZp686B2470, DKFZp686G18243, DKFZp686G2094, DKFZp781C1754, DKFZp781I1455, LIMCH1A, LMO7B, MGC72127

UniProt

Q9UPQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIMCH1 Rabbit Polyclonal Antibody (orb585391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055803

Preservative

Lyophilized powder

AA Sequence

EDVKPKTLPLDKSINHQIESPSERRKKSPREHFQAGPFSPCSPTPPGQSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 ubiquitin protein ligase MUL1 (MUL1) Rabbit Polyclonal Antibody
TA378802 100 µL

E3 ubiquitin protein ligase MUL1 (MUL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
METTL3 Antibody
KC-47503-01 50 μL

METTL3 Antibody

Sign In for Pricing
View Details
METTL3 Antibody
KC-47503-02 100 µL

METTL3 Antibody

Sign In for Pricing
View Details
METTL3 Antibody
KC-47503-03 1 mL

METTL3 Antibody

Sign In for Pricing
View Details
Guvacine Hydrochloride
TRC-G876400-25MG 25 mg

Guvacine Hydrochloride

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-500 1x 500 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details