Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIMCH1 Peptide - C-terminal region

LIMCH1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434I0312, DKFZp686A01247, DKFZp686B2470, DKFZp686G18243, DKFZp686G2094, DKFZp781C1754, DKFZp781I1455, LIMCH1A, LMO7B, MGC72127

UniProt

Q9UPQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIMCH1 Rabbit Polyclonal Antibody (orb585391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055803

Preservative

Lyophilized powder

AA Sequence

EDVKPKTLPLDKSINHQIESPSERRKKSPREHFQAGPFSPCSPTPPGQSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit
RD-PDGFC-Mu-01 96 Tests

Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit

Sign In for Pricing
View Details
Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit
RD-PDGFC-Mu-02 48 Tests

Mouse Platelet Derived Growth Factor C (PDGFC) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS508174 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Frozen Tissue Blocks, Soft tissue
CB602750 1 Block

Frozen Tissue Blocks, Soft tissue

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-100 1x 100 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS805712 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details