Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCKR Peptide - C-terminal region

GCKR Peptide - C-terminal region

Product Specifications

Product Name Alternative

GKRP, FGQTL5

UniProt

Q14397

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCKR Rabbit Polyclonal Antibody (orb331240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001477

Preservative

Lyophilized powder

AA Sequence

PIALLSLLFRCSITEAQAHLAAAPSVCEAVRSALAGPGQKRTADPLEILE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL12P5 siRNA Oligos set (Human)
40798171 3x 5 nmol

RPL12P5 siRNA Oligos set (Human)

Sign In for Pricing
View Details
WWP2 Antibody, HRP conjugated
A38519-50UG 50 µg

WWP2 Antibody, HRP conjugated

Sign In for Pricing
View Details
CELF4 (BRUNOL4, CUGBP Elav-like Family Member 4, CELF-4, Bruno-like Protein 4, CUG-BP- and ETR-3-like Factor 4, RNA-binding Protein BRUNOL-4) (MaxLight 550)
124016-ML550 100 µL

CELF4 (BRUNOL4, CUGBP Elav-like Family Member 4, CELF-4, Bruno-like Protein 4, CUG-BP- and ETR-3-like Factor 4, RNA-binding Protein BRUNOL-4) (MaxLight 550)

Sign In for Pricing
View Details
mmu-miR-7243-5p miRNA Inhibitor
MIM03057 2x 5.0 nmol

mmu-miR-7243-5p miRNA Inhibitor

Sign In for Pricing
View Details
Human ZFPL1 Knockout HEK293T cell line
GTR15403322 1 Vial

Human ZFPL1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Camel Melanocortin 5 Receptor ELISA Kit
MBS102691-01 48 Well

Camel Melanocortin 5 Receptor ELISA Kit

Sign In for Pricing
View Details