Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCKR Peptide - C-terminal region

GCKR Peptide - C-terminal region

Product Specifications

Product Name Alternative

GKRP, FGQTL5

UniProt

Q14397

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GCKR Rabbit Polyclonal Antibody (orb331240) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001477

Preservative

Lyophilized powder

AA Sequence

PIALLSLLFRCSITEAQAHLAAAPSVCEAVRSALAGPGQKRTADPLEILE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G6PD Antibody (Center) Blocking Peptide
MBS9225513-01 0.5 mg

G6PD Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
G6PD Antibody (Center) Blocking Peptide
MBS9225513-02 5x 0.5 mg

G6PD Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Cefpodoxime Proxetil EP Impurity A-d3 Sodium Salt
TMIJ-0219-01 1 mg

Cefpodoxime Proxetil EP Impurity A-d3 Sodium Salt

Sign In for Pricing
View Details
Cefpodoxime Proxetil EP Impurity A-d3 Sodium Salt
TMIJ-0219-02 5 mg

Cefpodoxime Proxetil EP Impurity A-d3 Sodium Salt

Sign In for Pricing
View Details
GSTt2 (Glutathione S Transferase Theta 2) BioAssayTM ELISA Kit (Mouse) discontinued
356159-01 48 Tests

GSTt2 (Glutathione S Transferase Theta 2) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
GSTt2 (Glutathione S Transferase Theta 2) BioAssayTM ELISA Kit (Mouse) discontinued
356159-02 96 Tests

GSTt2 (Glutathione S Transferase Theta 2) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details